• Peptidy prodej cena v České
  • Peptiden kopen prijs Nederland
  • Acquista pepitidi prezzo Italie
  • Comprar péptidos precio España
  • Peptide kaufen preis Deutschland
  • Peptides achat prix France

EnregistrerConnecter

PeptidesHGH

Acheter Follistatin en ligne en France - meilleur prix

 
Demander un rappel / SMS

Sending a message

Témoignages

Vous pouvez écrire un avis sur le magasin après l'achat!
Acheter Follistatin 1mg en France, meilleur prix. Commander Follistatin 1mg online.

Follistatin 1mg

  • 2199

  • 8

  • 3.12
  • 3.12

ANCIEN PRIX: €130
€ 100 (VOUS SAUVEGARDEZ: €30)

COMMANDER

C'est l'inhibiteur de myostatine le plus fort. En conséquence, il augmente votre poids musculaire et les résultats de la force.

Propriétés physiques et chimiques
Numéro CAS 80449-31-6
PubChem CID 16132341
Masse moléculaire 37800
Séquence GNCWLRQAKNGRCQV LYKTELSKEECCSTGRLS TSWTEEDVNDNTLFKWMIFNGGAP NCIPCKETCENVDCGPGKKCRMNKKNKPR CVCAPDCSNITWKGPVCGLDGKTY RNECALLKARCKEQPELEVQYQGRCKKT CRDVFCPGSSTCVVDQTNNAYCV TCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCI KAKSCEDIQCTGGKKCLWDFKV GRGRCSLCDELCPDSKSDEPVCASDNATYASE CAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Peptide pureity >85%
Solubilité Soluble dans l'eau - 100 μg/mL de diluant stérile (eau désionisée distillée)
Apparence physique Poudre lyophilisée blanche
Source Production biosynthétique (Synthèse chimique)
Termes Les produits que nous proposons sont destinés exclusivement à la recherche en laboratoire. Veuillez vous familiariser avec nos conditions générales avant la commande.
Taille de l'unité 1 mg/vial
Quantité unitaire 1 vial
Informations supplémentaires
Stockage Le sel Sel lyophilisé est stable à température ambiante pendant 90 jours, mais il doit être conservé dans un congélateur inférieur à -8°C pour toute période prolongée. Après avoir reconstitué Follistatin doit être réfrigéré à des températures ne dépassant pas 2°C.
AVERTISSEMENT Ce produit est un peptide lyophilisé uniquement pour la recherche. Ce produit n'est PAS utilisé à des fins humaines.
Les clients ayant acheté cet article ont également acheté:

Avis des clients