• Peptidy prodej cena v České
  • Peptiden kopen prijs Nederland
  • Acquista pepitidi prezzo Italie
  • Comprar péptidos precio España
  • Peptide kaufen preis Deutschland
  • Peptides achat prix France

RegistratiAccedi

PeptidesHGH

Acquisto Follistatin online in Italia - miglior prezzo

 
Richiesta una chiamata indietro / SMS

Sending a message

Testimonianze

Puoi scrivere una recensione su il negozio dopo l acquisto!
Acquisto Follistatin 1mg in Italia, miglior prezzo. Vendita Follistatin 1mg Online, costo sconto.

Follistatin 1mg

  • 2190

  • 8

  • 3.12
  • 3.12

VECCHIO PREZZO: €130
€ 100 (RISPARMI: €30)

Aggiungi al carrello

Dà buoni risultati in termini di crescita e la forza muscolare aumento. Non rilevato nel controllo antidoping. Color rosso Forse al sito di iniezione. Si raccomanda per gli uomini

Proprietà fisiche e chimiche
Numero CAS 80449-31-6
PubChem CID 16132341
Massa molecolare 37800
Sequenza GNCWLRQAKNGRCQV LYKTELSKEECCSTGRLS TSWTEEDVNDNTLFKWMIFNGGAP NCIPCKETCENVDCGPGKKCRMNKKNKPR CVCAPDCSNITWKGPVCGLDGKTY RNECALLKARCKEQPELEVQYQGRCKKT CRDVFCPGSSTCVVDQTNNAYCV TCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCI KAKSCEDIQCTGGKKCLWDFKV GRGRCSLCDELCPDSKSDEPVCASDNATYASE CAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Peptide purezza >85%
Solubilità Solubile in acqua - 100 μg/mL diluente sterile (acqua deionizzata distillata)
Aspetto fisico Polvere liofilizzata bianca
Origine Produzione biosintetica (sintesi chimica)
Termini I prodotti che offriamo sono destinati esclusivamente all'utilizzo della ricerca di laboratorio. Si prega di familiarizzare con i nostri Termini e condizioni prima di ordinare.
Dimensione unità 1 mg/vial
Quantità di unità 1 vial
Ulteriori informazioni
Memorizzazione Il liofilizzato Follistatin è stabile a temperatura ambiente per 90 giorni, tuttavia deve essere conservato in un congelatore sotto -8°C per un lungo periodo di tempo. Dopo ricostituzione di Follistatin deve essere refrigerato a temperature non superiori a 2°C.
ATTENZIONE Questo prodotto è un peptide liofilizzato solo per uso di ricerca. Questo prodotto NON è per uso umano.
I clienti che hanno acquistato questo prodotto hanno acquistato anche:

Recensioni dei clienti