• Peptidy prodej cena v České
  • Peptiden kopen prijs Nederland
  • Acquista pepitidi prezzo Italie
  • Comprar péptidos precio España
  • Peptide kaufen preis Deutschland
  • Peptides achat prix France

RegistroSign In

PeptidesHGH

Follistatin comprar en línea en Mexico - mejor precio

 
Solicitar llamada de vuelta / SMS

Sending a message

Testimonios

Usted puede escribir un comentario sobre la tienda despues de la compra!
Comprar Follistatin 1mg en Mexico, mejor precio. Venta de Follistatin 1mg en línea.

Follistatin 1mg

  • 2151

  • 8

  • 3.12
  • 3.12

PRECIO ANTERIOR: $2920
$ 2246 (AHORRAS: $674)

Vendidos

Da buenos resultados en el crecimiento muscular y aumento de la fuerza. No detectado en el control de dopaje. Quizás enrojecimiento en el sitio de la inyección. Se recomienda para los hombres

Propiedades físicas y químicas
Número CAS 80449-31-6
PubChem CID 16132341
Masa Molecular 37800
Secuencia GNCWLRQAKNGRCQV LYKTELSKEECCSTGRLS TSWTEEDVNDNTLFKWMIFNGGAP NCIPCKETCENVDCGPGKKCRMNKKNKPR CVCAPDCSNITWKGPVCGLDGKTY RNECALLKARCKEQPELEVQYQGRCKKT CRDVFCPGSSTCVVDQTNNAYCV TCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCI KAKSCEDIQCTGGKKCLWDFKV GRGRCSLCDELCPDSKSDEPVCASDNATYASE CAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Pureza del péptido >85%
Solubilidad Soluble en agua - 100 μg/mL de diluyente estéril (agua destilada desionizada)
Apariencia Física Polvo blanco liofilizado
Fuente Producción biosintética (síntesis química)
Términos Los productos que ofrecemos están destinados exclusivamente a la investigación en laboratorios. Por favor, familiarícese con nuestros Términos y condiciones antes de realizar el pedido.
Tamaño de la Unidad 1 mg/vial
Cantidad de unidad 1 vial
Información adicional
Almacenamiento Follistatin liofilizado es estable a temperatura ambiente durante 90 días, sin embargo, debe ser almacenado en un congelador por debajo de -8°C durante un período prolongado de tiempo. Después de reconstituir Follistatin se debe refrigerar a temperaturas que no excedan los 2°C.
ADVERTENCIA Este producto es un péptido liofilizado sólo para uso en investigación. Este producto NO es para uso humano.
Los clientes que compraron este artículo también compraron:

Opiniones de los usuarios