• Peptidy prodej cena v České
  • Peptiden kopen prijs Nederland
  • Acquista pepitidi prezzo Italie
  • Comprar péptidos precio España
  • Peptide kaufen preis Deutschland
  • Peptides achat prix France

RegistrarEntrar

PeptidesHGH

Follistatin comprar online no Brasil - melhor preço

 
Pedir uma chamada de volta / SMS

Sending a message

Comentários

Você pode escrever um comentário sobre a loja após a compra!
Comprar Follistatin 1mg no Brasil, melhor preço. Venda de Follistatin 1mg online

Follistatin 1mg

  • 2149

  • 8

  • 3.12
  • 3.12

PREÇO ANTIGO: R$503
R$ 387 (VOCÊ SALVA: R$116)

Comprar

Ele dá bons resultados no crescimento muscular e aumento da força. Não detectado no controle de doping. Talvez vermelhidão no local da injecção. É recomendado para homens

Propriedades físicas e químicas
CAS Number 80449-31-6
PubChem CID 16132341
Massa molecular 37800
Seqüência GNCWLRQAKNGRCQV LYKTELSKEECCSTGRLS TSWTEEDVNDNTLFKWMIFNGGAP NCIPCKETCENVDCGPGKKCRMNKKNKPR CVCAPDCSNITWKGPVCGLDGKTY RNECALLKARCKEQPELEVQYQGRCKKT CRDVFCPGSSTCVVDQTNNAYCV TCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCI KAKSCEDIQCTGGKKCLWDFKV GRGRCSLCDELCPDSKSDEPVCASDNATYASE CAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Pureza do péptido >85%
Solubilidade Solúvel em água - diluente estéril 100 μg/mL (água desionada desionada)
Physical appearance Pó branco liofilizado
Source Produção biossintética (síntese química)
Termos Os produtos que oferecemos são destinados exclusivamente a pesquisas laboratoriais. Familiarize-se com os nossos Termos e condições antes da encomenda.
Tamanho da Unidade 1 mg/vial
Quantidade da unidade 1 vial
Informações adicionais
Storage Follistatin liofilizado é estável a temperatura ambiente durante 90 dias, no entanto, ele deve ser armazenado em um congelador abaixo de -8°C por qualquer período prolongado de tempo. Após a reconstituição, a Follistatin deve ser refrigerada a temperaturas não superiores a 2°C.
AVISO Este produto é um péptido liofilizado apenas para uso em pesquisa. Este produto NÃO é para uso humano.
Clientes que compraram este item, também compraram:

Avaliações de Clientes