• Peptidy prodej cena v České
  • Peptiden kopen prijs Nederland
  • Acquista pepitidi prezzo Italie
  • Comprar péptidos precio España
  • Peptide kaufen preis Deutschland
  • Peptides achat prix France

InregistrareConectați-vă

PeptidesHGH

Comprar Follistatin online în România - cel mai bun preț

 
Cerere un apel inapoi / SMS

Sending a message

Recenzii

Puteți scrie o recenzie despre magazin după cumpărare!
Comprar Follistatin 1mg în România, cel mai bun preț. Follistatin 1mg de vanzare online.

Follistatin 1mg

  • 2400

  • 8

  • 3.12
  • 3.12

PREȚ VECHI: L602
L 463 (TU SALVEZI: L139)

Adauga in cos

Acesta ofer?? rezultate bune în cresterea masei musculare ?™i cre?™te puterea. Nu a fost detectat în controlul doping. Poate ro?™ea?›?? la locul de injectare. Se recomand?? pentru barbati

Proprietăți fizice și chimice
Număr CAS 80449-31-6
PubChem CID 16132341
Masa moleculară 37800
Secvență GNCWLRQAKNGRCQV LYKTELSKEECCSTGRLS TSWTEEDVNDNTLFKWMIFNGGAP NCIPCKETCENVDCGPGKKCRMNKKNKPR CVCAPDCSNITWKGPVCGLDGKTY RNECALLKARCKEQPELEVQYQGRCKKT CRDVFCPGSSTCVVDQTNNAYCV TCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCI KAKSCEDIQCTGGKKCLWDFKV GRGRCSLCDELCPDSKSDEPVCASDNATYASE CAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Peptide purity >85%
Solubilitate Solubil în apă - 100 μg/mL diluant steril (apă deionizată distilată)
Aspect fizic Pudră albă liofilizată
Sursă Producția biosintetică (sinteza chimică)
Condiții Produsele pe care le oferim sunt destinate exclusiv cercetării în laborator. Vă rugăm să vă familiarizați cu Termenii și condițiile noastre înainte de a comanda.
Dimensiune unitate 1 mg/vial
Cantitate unitară 1 vial
Informații suplimentare
Depozitare Soluția liofilizată este stabilă la temperatura camerei timp de 90 de zile, însă ar trebui să fie depozitată într-un congelator sub -8°C pentru orice perioadă extinsă de timp. După reconstituire, Follistatin trebuie să fie refrigerat la temperaturi care să nu depășească 2°C.
AVERTISMENT Acest produs este o peptidă liofilizată numai pentru cercetare. Acest produs nu este destinat uzului uman.
Clientii care au cumparat acest produs au mai achizitionat si:

Recenzii clienți