• Peptidy prodej cena v České
  • Peptiden kopen prijs Nederland
  • Acquista pepitidi prezzo Italie
  • Comprar péptidos precio España
  • Peptide kaufen preis Deutschland
  • Peptides achat prix France

RegistrierenAnmelden

PeptidesHGH

Follistatin online kaufen in Deutschland - Besten Preis

 
Rückruf anfordern / SMS

Sending a message

Testimonials

Wir freuen uns uber das Geschaft nach dem Kauf schreiben!
Follistatin 1mg kaufen in Deutschland, Besten Preis. Follistatin 1mg bestellen online

Follistatin 1mg

  • 3456

  • 8

  • 3.12
  • 3.12

ALTER PREIS: €130
€ 100 (DU SPARST: €30)

Kaufen

Es gibt gute Ergebnisse im Muskelaufbau und Kraftzuwachs. Nicht in der Dopingkontrolle festgestellt. Vielleicht Rötung an der Injektionsstelle. Es empfiehlt für Männer

Physikalische und chemische Eigenschaften
CAS-Nummer 80449-31-6
PubChem CID 16132341
Molecular Masse 37800
Sequence GNCWLRQAKNGRCQV LYKTELSKEECCSTGRLS TSWTEEDVNDNTLFKWMIFNGGAP NCIPCKETCENVDCGPGKKCRMNKKNKPR CVCAPDCSNITWKGPVCGLDGKTY RNECALLKARCKEQPELEVQYQGRCKKT CRDVFCPGSSTCVVDQTNNAYCV TCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCI KAKSCEDIQCTGGKKCLWDFKV GRGRCSLCDELCPDSKSDEPVCASDNATYASE CAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Peptidreinheit >85%
Löslichkeit Löslich in Wasser - 100 μg/mL steriles Verdünnungsmittel (destilliertes deionisiertes Wasser)
Physisches Aussehen Weißes Lyophilisiertes Pulver
Quelle Biosynthetische Produktion (Chemische Synthese)
Begriffe Die Produkte, die wir anbieten, sind nur für Laborforschung gedacht. Bitte machen Sie sich mit unseren AGBs vor der Bestellung vertraut.
Synonyme FST-344
Einheit Größe 1 mg/vial
Einheitsmenge 1 vial
Zusätzliche Informationen
Speicher Lyophilisierter Follistatin ist bei Raumtemperatur für 90 Tage stabil, sollte aber in einem Gefrierschrank unter -8°C für längere Zeit gelagert werden. Nach der Wiederherstellung sollte Follistatin bei Temperaturen von nicht mehr als 2°C gekühlt werden.
WARNUNG Dieses Produkt ist ein lyophilisiertes Peptid für Forschungszwecke nur. Dieses Produkt ist NICHT für den menschlichen Gebrauch.
Kunden, die diesen Artikel kauften, kauften auch:

Kundenbewertungen