• Peptidy prodej cena v České
  • Peptiden kopen prijs Nederland
  • Acquista pepitidi prezzo Italie
  • Comprar péptidos precio España
  • Peptide kaufen preis Deutschland
  • Peptides achat prix France

RegistreerAanmelden

PeptidesHGH

Follistatin kopen online in Nederland - beste prijs

 
Vraag een call back / SMS

Sending a message

Getuigenissen

U kunt schrijven van een review over de winkel na de aankoop!
Follistatin 1mg kopen in Nederland, beste prijs. Follistatin 1mg online bestellen.

Follistatin 1mg

  • 2447

  • 8

  • 3.12
  • 3.12

OUDE PRIJS: €130
€ 100 (JE BESPAART: €30)

In winkelwagen

Het geeft goede resultaten in de groei van spieren en kracht toenemen. Niet gedetecteerd in de dopingcontrole. Misschien roodheid op de injectieplaats. Aanbevolen voor mannen

Fysische en chemische eigenschappen
CAS nummer 80449-31-6
PubChem CID 16132341
Moleculaire massa 37800
Sequence GNCWLRQAKNGRCQV LYKTELSKEECCSTGRLS TSWTEEDVNDNTLFKWMIFNGGAP NCIPCKETCENVDCGPGKKCRMNKKNKPR CVCAPDCSNITWKGPVCGLDGKTY RNECALLKARCKEQPELEVQYQGRCKKT CRDVFCPGSSTCVVDQTNNAYCV TCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCI KAKSCEDIQCTGGKKCLWDFKV GRGRCSLCDELCPDSKSDEPVCASDNATYASE CAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Peptide purity >85%
Oplosbaarheid Oplosbaar in water - 100 μg/mL steriel verdunningsmiddel (gedestilleerd gedeioniseerd water)
Fysieke verschijning Wit gefijofiliseerd poeder
Bron Biosynthetische productie (Chemische synthese)
Voorwaarden De producten die wij aanbieden zijn uitsluitend bestemd voor laboratoriumonderzoek. Maak alstublieft kennis met onze algemene voorwaarden voorafgaand aan het bestellen.
Unit Size 1 mg/vial
Unit quantity 1 vial
Extra informatie
Opslag Gelyofiliseerde Follistatin is 90 dagen stabiel bij kamertemperatuur, maar dient gedurende een langere periode in een vriezer onder -8°C te worden opgeslagen. Na reconstitutie moet Follistatin gekoeld worden bij temperaturen die niet hoger zijn dan 2°C.
WAARSCHUWING Dit product is een gelofiliseerd peptide voor onderzoeksgebruik. Dit product is NIET voor menselijk gebruik.
Klanten die dit artikel kochten, kochten ook:

Klanten-reviews