• Peptidy prodej cena v České
  • Peptiden kopen prijs Nederland
  • Acquista pepitidi prezzo Italie
  • Comprar péptidos precio España
  • Peptide kaufen preis Deutschland
  • Peptides achat prix France

KayitOturum Aç

PeptidesHGH

Türkiye'de Follistatin satın al - en iyi fiyat

 
Talebi geri arama / SMS

Sending a message

Görüşler

Satın aldıktan sonra mağaza hakkında bir inceleme yazabilirsiniz!
Türkiye'de online Follistatin 1mg satın al, en iyi fiyat Türkiye. Follistatin 1mg online satış.

Follistatin 1mg

  • 2145

  • 8

  • 3.12
  • 3.12

ESKI FIYAT: TL596
TL 459 (KAZANIYORSUN: TL137)

Sepete Ekle

Bu kas büyümesi ve artması gücü iyi sonuçlar verir. Doping kontrolü tespit edilmedi. Belki enjeksiyon yerinde kızarıklık. Bu erkekler için tavsiye

Fiziksel ve kimyasal özellikler
CAS Numarası 80449-31-6
PubChem CID 16132341
Molekül kütlesi 37800
Sıra GNCWLRQAKNGRCQV LYKTELSKEECCSTGRLS TSWTEEDVNDNTLFKWMIFNGGAP NCIPCKETCENVDCGPGKKCRMNKKNKPR CVCAPDCSNITWKGPVCGLDGKTY RNECALLKARCKEQPELEVQYQGRCKKT CRDVFCPGSSTCVVDQTNNAYCV TCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCI KAKSCEDIQCTGGKKCLWDFKV GRGRCSLCDELCPDSKSDEPVCASDNATYASE CAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Peptid saflığı >85%
Çözünürlük Suda çözünür - 100 μg/mL steril seyreltici (damıtılmış deiyonize su)
Fiziksel görünüm Beyaz liyofilize toz
Kaynak Biyosentetik üretim (Kimyasal Sentez)
Şartlar Sunduğumuz ürünler sadece laboratuvar araştırması için tasarlanmıştır. Lütfen sipariş vermeden önce Şartlar ve Koşullarımızı öğrenin.
Birim Boyutu 1 mg/vial
Birim miktarı 1 vial
Ek bilgi
Depolama Alanı Liyofilize Follistatin oda sıcaklığında 90 gün boyunca stabildir, ancak herhangi bir uzun süre -8°C'nin altında bir dondurucuda saklanmalıdır. Follistatin'ın yeniden yapılandırılmasından sonra 2°C'yi aşmayacak sıcaklıklarda soğutulması gerekir.
UYARI Bu ürün yalnızca araştırma için liyofilize edilmiş bir peptiddir. Bu ürün insan kullanımı için DEĞİLDİR.
Bu ürünü alan müşteriler aynı zamanda bu ürünleri satın aldılar:

Musteri değerlendirmeleri