• Peptidy prodej cena v České
  • Peptiden kopen prijs Nederland
  • Acquista pepitidi prezzo Italie
  • Comprar péptidos precio España
  • Peptide kaufen preis Deutschland
  • Peptides achat prix France

RegisztrációBejelentkezés

PeptidesHGH

Follistatin vásárlás online - legjobb ár

 
Kerjen visszahivast / SMS

Sending a message

Vélemények

A vásárlás után írhatsz véleményt az áruházról!
Follistatin 1mg vásárlás Magyarországon, legjobb ár. Follistatin 1mg rendelés online

Follistatin 1mg

  • 2448

  • 8

  • 3.12
  • 3.12

RÉGI ÁR: Ft40746
Ft 31343 (MEGMENT: Ft9403)

KOSÁRBA RAKOM

Ez ad jó eredményeket az izomnövekedést és növeli erejét. Nem lehetett kimutatni a dopping kontroll. Talán bőrpír az injekció helyén. Azt javasolta a férfiak

Fizikai és kémiai tulajdonságok
CAS szám 80449-31-6
PubChem CID 16132341
Molekulatömeg 37800
Szekvencia GNCWLRQAKNGRCQV LYKTELSKEECCSTGRLS TSWTEEDVNDNTLFKWMIFNGGAP NCIPCKETCENVDCGPGKKCRMNKKNKPR CVCAPDCSNITWKGPVCGLDGKTY RNECALLKARCKEQPELEVQYQGRCKKT CRDVFCPGSSTCVVDQTNNAYCV TCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCI KAKSCEDIQCTGGKKCLWDFKV GRGRCSLCDELCPDSKSDEPVCASDNATYASE CAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Peptid tisztaság >85%
Oldékonyság Vízben oldódik - 100 μg/mL steril hígítószer (desztillált deionizált víz)
Fizikai megjelenés Fehér liofilizált por
Forrás Bioszintetikus termelés (kémiai szintézis)
Feltételek Az általunk kínált termékek kizárólag laboratóriumi kutatásra használhatók. Kérjük, ismerje meg az Általános Szerződési Feltételeket a megrendelés előtt.
Egységméret 1 mg/vial
Egységmennyiség 1 vial
További információk
Tárolás A Lyophilized Follistatin szobahőmérsékleten 90 napig stabil, azonban az egyiket hosszabb ideig tartó, -8°C alatti mélyhűtőben kell tárolni. A Follistatin feloldása után hűteni kell a 2°C-ot meg nem haladó hőmérsékleten.
FIGYELEM Ez a termék liofilizált peptid kizárólag kutatási célokra. Ez a termék NEM emberi használatra készült.
Azok a vásárlók akik megvásárolták ezt az árut szintén megvásárolták:

Vásárlói vélemények