• Peptidy prodej cena v České
  • Peptiden kopen prijs Nederland
  • Acquista pepitidi prezzo Italie
  • Comprar péptidos precio España
  • Peptide kaufen preis Deutschland
  • Peptides achat prix France

RegisterLogg på

PeptidesHGH

Kjøpe Follistatin på nett i Norge - beste pris

 
Be om en samtale tilbake / SMS

Sending a message

Betroelser

Du kan skrive en anmeldelse om butikken etter kjøpet!
Kjøp Follistatin 1mg i Norge, beste pris. Bestille Follistatin 1mg på nett

Follistatin 1mg

  • 2446

  • 8

  • 3.12
  • 3.12

GAMMEL PRIS: kr1272
kr 978 (DU SPARER: kr294)

KJØP NÅ

Det gir gode resultater i muskelvekst og økning styrke. Ikke oppdaget i doping kontroll. Kanskje rødhet på injeksjonsstedet. Det anbefales for menn

Fysiske og kjemiske egenskaper
CAS nummer 80449-31-6
PubChem CID 16132341
Molekylær masse 37800
sekvens GNCWLRQAKNGRCQV LYKTELSKEECCSTGRLS TSWTEEDVNDNTLFKWMIFNGGAP NCIPCKETCENVDCGPGKKCRMNKKNKPR CVCAPDCSNITWKGPVCGLDGKTY RNECALLKARCKEQPELEVQYQGRCKKT CRDVFCPGSSTCVVDQTNNAYCV TCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCI KAKSCEDIQCTGGKKCLWDFKV GRGRCSLCDELCPDSKSDEPVCASDNATYASE CAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Peptidrenhet >85%
Løselighet Løselig i vann - 100 μg/mL sterilt fortynningsmiddel (destillert deionisert vann)
Fysisk utseende Hvit lyofilisert pulver
Kilde Biosyntetisk produksjon (kjemisk syntese)
Vilkår Produktene vi tilbyr er kun beregnet for laboratorieforskning. Vennligst gjør deg kjent med våre vilkår og betingelser før du bestiller.
Enhetsstørrelse 1 mg/vial
Enhetskvantitet 1 vial
Tilleggsinformasjon
Lagring Lyofilisert Follistatin er stabil ved romtemperatur i 90 dager, men den skal lagres i en fryser under -8°C i en lengre periode. Etter rekonstituering skal Follistatin kjøles i temperaturer som ikke overstiger 2°C.
ADVARSEL Dette produktet er et lyofilisert peptid kun for forskningsbruk. Dette produktet er IKKE til human bruk.
Kunder som kjøpte denne varen kjøpte også:

Kunde anmeldelser