• Peptidy prodej cena v České
  • Peptiden kopen prijs Nederland
  • Acquista pepitidi prezzo Italie
  • Comprar péptidos precio España
  • Peptide kaufen preis Deutschland
  • Peptides achat prix France

TilmeldLog ind

PeptidesHGH

Follistatin køb online Danmark - bedste pris

 
Anmodning et opkald tilbage / SMS

Sending a message

Beretninger

Du kan skrive en anmeldelse om butikken efter købet!
Køb Follistatin 1mg i Danmark, bedste pris. Bestil Follistatin 1mg online

Follistatin 1mg

  • 2153

  • 8

  • 3.12
  • 3.12

GAMMEL PRIS: kr967
kr 744 (DU REDDER: kr223)

BESTIL NU

Det giver gode resultater i muskelvækst og øge styrken. Ikke påvist i dopingkontrol. Måske rødme på injektionsstedet. Det anbefales til mænd

Fysiske og kemiske egenskaber
CAS-nummer 80449-31-6
PubChem CID 16132341
Molekylmasse 37800
Sekvens GNCWLRQAKNGRCQV LYKTELSKEECCSTGRLS TSWTEEDVNDNTLFKWMIFNGGAP NCIPCKETCENVDCGPGKKCRMNKKNKPR CVCAPDCSNITWKGPVCGLDGKTY RNECALLKARCKEQPELEVQYQGRCKKT CRDVFCPGSSTCVVDQTNNAYCV TCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCI KAKSCEDIQCTGGKKCLWDFKV GRGRCSLCDELCPDSKSDEPVCASDNATYASE CAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Peptidrenhed >85%
Opløselighed Opløseligt i vand - 100 μg/mL sterilt fortyndingsmiddel (destilleret deioniseret vand)
Fysisk udseende Hvidt lyofiliseret pulver
Source Biosyntetisk produktion (kemisk syntese)
Vilkår De produkter, vi tilbyder, er kun beregnet til laboratorieforskning. Vær opmærksom på vores vilkår og betingelser før bestilling.
Enhedsstørrelse 1 mg/vial
Enhedskvantitet 1 vial
Yderligere oplysninger
Lager Lyofiliseret Follistatin er stabilt ved stuetemperatur i 90 dage, men det bør opbevares i en fryser under -8°C i en længere periode. Efter rekonstituering skal Follistatin køles ved temperaturer, der ikke overstiger 2°C.
ADVARSEL Dette produkt er et lyofiliseret peptid til forskningsbrug. Dette produkt er IKKE til human brug.
Kunder, der købte denne vare købte også:

Kunde anmeldelser