• Peptidy prodej cena v České
  • Peptiden kopen prijs Nederland
  • Acquista pepitidi prezzo Italie
  • Comprar péptidos precio España
  • Peptide kaufen preis Deutschland
  • Peptides achat prix France

RegistreraLogga in

PeptidesHGH

Köp Follistatin På Nätet i Sverige - bästa pris

 
Begär tillbaka ett samtal / SMS

Sending a message

Testimonials

Du kan skriva en recension om butiken efter köpet!
Köp Follistatin 1mg i Sverige - bästa pris. Beställ Follistatin 1mg online.

Follistatin 1mg

  • 2449

  • 8

  • 3.12
  • 3.12

GAMMALT PRIS: kr1295
kr 996 (DU SPARAR: kr299)

Lägg till i kundvagn

Det ger goda resultat i muskeltillväxt och ökad styrka. Inte registreras i dopingkontroll. Kanske rodnad vid injektionsstället. Det rekommenderas för mäns

Fysikaliska och kemiska egenskaper
CAS-nummer 80449-31-6
PubChem CID 16132341
Molekylmassa 37800
sekvens GNCWLRQAKNGRCQV LYKTELSKEECCSTGRLS TSWTEEDVNDNTLFKWMIFNGGAP NCIPCKETCENVDCGPGKKCRMNKKNKPR CVCAPDCSNITWKGPVCGLDGKTY RNECALLKARCKEQPELEVQYQGRCKKT CRDVFCPGSSTCVVDQTNNAYCV TCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCI KAKSCEDIQCTGGKKCLWDFKV GRGRCSLCDELCPDSKSDEPVCASDNATYASE CAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Peptidrenhet >85%
Löslighet Lösligt i vatten - 100 μg/mL sterilt utspädningsmedel (destillerat avjoniserat vatten)
Fysiskt utseende Vit lyofiliserat pulver
Source Biosyntetisk produktion (kemisk syntes)
Villkor De produkter vi erbjuder är endast avsedda för användning i laboratorieforskning. Vänligen bekanta dig med våra användarvillkor innan du beställer.
Enhetsstorlek 1 mg/vial
Enhetskvantitet 1 vial
Ytterligare information
Lagring Lyofiliserad Follistatin är stabil vid rumstemperatur i 90 dagar, men den bör förvaras i en frys under -8°C under en längre tid. Efter reconstitution bör Follistatin kylas vid temperaturer som inte överstiger 2°C.
VARNING Denna produkt är en lyofiliserad peptid för forskningsanvändning. Denna produkt är INTE för human användning.
Kunder som köpt denna vara har också köpt:

Recensioner