• Peptidy prodej cena v České
  • Peptiden kopen prijs Nederland
  • Acquista pepitidi prezzo Italie
  • Comprar péptidos precio España
  • Peptide kaufen preis Deutschland
  • Peptides achat prix France

RegistracePřihlášení

PeptidesHGH

Koupit Follistatin online v ČR - nejlepší cena

 
Zadost o zpetne volani / SMS

Sending a message

Ohlasy

Muzete napsat recenzi o obchodu po nakupu!
Koupit Follistatin 1mg v České, nejlepší cena. Follistatin 1mg prodej online.

Follistatin 1mg

  • 2147

  • 8

  • 3.12
  • 3.12

STARÁ CENA: Kčs3326
Kčs 2559 (UŠETŘÍŠ: Kčs767)

Koupit

To dává dobré výsledky v růstu svalů a zvýšení síly. Není detekován v kontroly dopingu. Možná, zarudnutí v místě vpichu. Je doporučeno pro muže

Fyzikální a chemické vlastnosti
Číslo CAS 80449-31-6
PubChem CID 16132341
Molekulární hmotnost 37800
Sekvence GNCWLRQAKNGRCQV LYKTELSKEECCSTGRLS TSWTEEDVNDNTLFKWMIFNGGAP NCIPCKETCENVDCGPGKKCRMNKKNKPR CVCAPDCSNITWKGPVCGLDGKTY RNECALLKARCKEQPELEVQYQGRCKKT CRDVFCPGSSTCVVDQTNNAYCV TCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCI KAKSCEDIQCTGGKKCLWDFKV GRGRCSLCDELCPDSKSDEPVCASDNATYASE CAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Peptide Purity >85%
Rozpustnost Rozpustný ve vodě - 100 μg/mL sterilního ředidla (destilovaná deionizovaná voda)
Fyzický vzhled Bílý lyofilizovaný prášek
Zdroj Biosyntetická výroba (chemická syntéza)
Podmínky Produkty, které nabízíme, jsou určeny pouze pro laboratorní výzkum. Před objednáním se obraťte na naše Smluvní podmínky.
Velikost jednotky 1 mg/vial
Jednotkové množství 1 vial
Další informace
Úložiště Lyofilizovaný přípravek Follistatin je stabilní při pokojové teplotě po dobu 90 dnů, avšak po delší dobu by měl být skladován v mrazáku pod -8°C. Po rekonstituci by měl být přípravek Follistatin uchováván v chladničce při teplotách nepřesahujících 2°C.
UPOZORNĚNÍ Tento produkt je lyofilizovaný peptid pouze pro výzkumné účely. Tento výrobek NENÍ určen pro lidské použití.
Zákazníci, kteří si koupili tuto položku, si rovněž koupili:

Hodnocení zákazníků