• Peptidy prodej cena v České
  • Peptiden kopen prijs Nederland
  • Acquista pepitidi prezzo Italie
  • Comprar péptidos precio España
  • Peptide kaufen preis Deutschland
  • Peptides achat prix France

RejestracjaZaloguj sie

PeptidesHGH

Kup Follistatin w Polsce online - najlepsza cena

 
Popros o oddzwonienie / SMS

Sending a message

Referencje

Po zakupie możesz napisać recenzję sklepu!
Kup Follistatin 1mg w Polsce, najlepsza cena. Sprzedam Follistatin 1mg sklep online

Follistatin 1mg

  • 2148

  • 8

  • 3.12
  • 3.12

STARA CENA: zł550
zł 423 (OSZCZĘDZASZ: zł127)

Do koszyka

To daje dobre wyniki w rozwoju mięśni i wzrost siły. Nie wykryto w kontroli dopingu. Być może zaczerwienienie w miejscu wstrzyknięcia. Polecany dla mężczyzn

Właściwości fizykochemiczne
Numer CAS 80449-31-6
PubChem CID 16132341
Masa molekularna 37800
Sekwencja GNCWLRQAKNGRCQV LYKTELSKEECCSTGRLS TSWTEEDVNDNTLFKWMIFNGGAP NCIPCKETCENVDCGPGKKCRMNKKNKPR CVCAPDCSNITWKGPVCGLDGKTY RNECALLKARCKEQPELEVQYQGRCKKT CRDVFCPGSSTCVVDQTNNAYCV TCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCI KAKSCEDIQCTGGKKCLWDFKV GRGRCSLCDELCPDSKSDEPVCASDNATYASE CAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Czystość peptydów >85%
Rozpuszczalność Rozpuszczalny w wodzie - 100 μg/mL sterylnego rozcieńczalnika (destylowana dejonizowana woda)
Wygląd fizyczny Biały Liofilizowany Proszek
Źródło Produkcja biosyntezy (synteza chemiczna)
Warunki Oferowane przez nas produkty są przeznaczone wyłącznie do badań laboratoryjnych. Zapoznaj się z Warunkami korzystania z usługi przed zamówieniem.
Rozmiar jednostki 1 mg/vial
Jednostka miary 1 vial
Dodatkowe informacje
Magazynowanie Liofilizowany Follistatin jest stabilny w temperaturze pokojowej przez 90 dni, jednakże powinien być przechowywany w zamrażarce poniżej -8°C przez dłuższy okres czasu. Po rekonstytuowaniu Follistatin należy przechowywać w lodówce w temperaturach nie przekraczających 2°C.
OSTRZEŻENIE Ten produkt jest liofilizowanym peptydem do celów badawczych. Ten produkt NIE jest przeznaczony dla ludzi.
Klienci którzy kupili ten produkt kupili również:

Opinie klientów