• Peptidy prodej cena v České
  • Peptiden kopen prijs Nederland
  • Acquista pepitidi prezzo Italie
  • Comprar péptidos precio España
  • Peptide kaufen preis Deutschland
  • Peptides achat prix France

RegistraciaPrihlasit sa

PeptidesHGH

Kúpiť Follistatin onilne na Slovensku - najlepšia cena

 
Ziadost o spatne volanie / SMS

Sending a message

Recenzie

Mozete napisat recenziu o obchode po nakupe!
Kúpiť Follistatin 1mg na Slovensku, najlepšia cena. Follistatin 1mg Predaj Online

Follistatin 1mg

  • 2198

  • 8

  • 3.12
  • 3.12

STARÁ CENA: €130
€ 100 (UŠETRÍTE: €30)

DO KOŠÍKA

Je to najsilnejší inhibítor myostatínu. Výsledkom je zvýšenie svalovej hmotnosti a sily výsledkov.

Fyzikálne a chemické vlastnosti
Číslo CAS 80449-31-6
PubChem CID 16132341
Molekulová hmotnosť 37800
Sekvencia GNCWLRQAKNGRCQV LYKTELSKEECCSTGRLS TSWTEEDVNDNTLFKWMIFNGGAP NCIPCKETCENVDCGPGKKCRMNKKNKPR CVCAPDCSNITWKGPVCGLDGKTY RNECALLKARCKEQPELEVQYQGRCKKT CRDVFCPGSSTCVVDQTNNAYCV TCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCI KAKSCEDIQCTGGKKCLWDFKV GRGRCSLCDELCPDSKSDEPVCASDNATYASE CAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Peptide purity >85%
Rozpustnosť Rozpustný vo vode - 100 μg/mL sterilného riedidla (destilovaná deionizovaná voda)
Fyzický vzhľad Biely lyofilizovaný prášok
Zdroj Biosyntetická výroba (chemická syntéza)
Podmienky Produkty, ktoré ponúkame, sú určené len na laboratórne použitie. Pred objednaním sa oboznámte s našimi zmluvnými podmienkami.
Veľkosť jednotky 1 mg/vial
Množstvo jednotiek 1 vial
Ďalšie informácie
Úložisko Lyo fi lizovaný Follistatin je stabilný pri izbovej teplote počas 90 dní, avšak musí byť skladovaný v mrazničke pod -8°C počas dlhšieho časového obdobia. Po rekonštitúcii by sa mal Follistatin uchovávať v chladničke pri teplotách nepresahujúcich 2°C.
UPOZORNENIE Tento produkt je lyofilizovaný peptid len na výskumné účely. Tento výrobok NIE JE pre ľudské použitie.
Zákazníci, ktorí si kúpili túto položku, si tiež kúpili:

Hodnotenia zákazníkov